Lineage for d1v6oe_ (1v6o E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778663Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. 2778744Domain d1v6oe_: 1v6o E: [100419]
    complexed with ca, mn

Details for d1v6oe_

PDB Entry: 1v6o (more details), 3 Å

PDB Description: peanut lectin complexed with 10mer peptide (pvriwssatg)
PDB Compounds: (E:) Galactose-binding lectin

SCOPe Domain Sequences for d1v6oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6oe_ b.29.1.1 (E:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1v6oe_:

Click to download the PDB-style file with coordinates for d1v6oe_.
(The format of our PDB-style files is described here.)

Timeline for d1v6oe_: