Lineage for d1v6oa_ (1v6o A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 556138Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (16 PDB entries)
  8. 556183Domain d1v6oa_: 1v6o A: [100415]

Details for d1v6oa_

PDB Entry: 1v6o (more details), 3 Å

PDB Description: peanut lectin complexed with 10mer peptide (pvriwssatg)

SCOP Domain Sequences for d1v6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6oa_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1v6oa_:

Click to download the PDB-style file with coordinates for d1v6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1v6oa_: