Lineage for d1v6me_ (1v6m E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663507Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
  8. 663572Domain d1v6me_: 1v6m E: [100403]

Details for d1v6me_

PDB Entry: 1v6m (more details), 2.7 Å

PDB Description: peanut lectin with 9mer peptide (iwssagnva)
PDB Compounds: (E:) Galactose-binding lectin

SCOP Domain Sequences for d1v6me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6me_ b.29.1.1 (E:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1v6me_:

Click to download the PDB-style file with coordinates for d1v6me_.
(The format of our PDB-style files is described here.)

Timeline for d1v6me_: