![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries) Uniprot P02872 24-255 |
![]() | Domain d1v6me_: 1v6m E: [100403] complexed with ca, mn |
PDB Entry: 1v6m (more details), 2.7 Å
SCOPe Domain Sequences for d1v6me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6me_ b.29.1.1 (E:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d1v6me_: