Lineage for d1v6lc_ (1v6l C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 460110Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (14 PDB entries)
  8. 460125Domain d1v6lc_: 1v6l C: [100397]

Details for d1v6lc_

PDB Entry: 1v6l (more details), 2.5 Å

PDB Description: peanut lectin-lactose complex in the presence of 9mer peptide (pviwssatg)

SCOP Domain Sequences for d1v6lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6lc_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1v6lc_:

Click to download the PDB-style file with coordinates for d1v6lc_.
(The format of our PDB-style files is described here.)

Timeline for d1v6lc_: