![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (4 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (14 PDB entries) |
![]() | Domain d1v6jd_: 1v6j D: [100390] complexed with ca, gal, glc, mn |
PDB Entry: 1v6j (more details), 2.9 Å
SCOP Domain Sequences for d1v6jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6jd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea)} aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d1v6jd_: