Lineage for d1v6jc_ (1v6j C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388337Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. 2388399Domain d1v6jc_: 1v6j C: [100389]
    complexed with ca, mn

Details for d1v6jc_

PDB Entry: 1v6j (more details), 2.9 Å

PDB Description: peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph
PDB Compounds: (C:) Galactose-binding lectin

SCOPe Domain Sequences for d1v6jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6jc_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1v6jc_:

Click to download the PDB-style file with coordinates for d1v6jc_.
(The format of our PDB-style files is described here.)

Timeline for d1v6jc_: