Lineage for d1v6jb_ (1v6j B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663507Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
  8. 663549Domain d1v6jb_: 1v6j B: [100388]

Details for d1v6jb_

PDB Entry: 1v6j (more details), 2.9 Å

PDB Description: peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph
PDB Compounds: (B:) Galactose-binding lectin

SCOP Domain Sequences for d1v6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6jb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1v6jb_:

Click to download the PDB-style file with coordinates for d1v6jb_.
(The format of our PDB-style files is described here.)

Timeline for d1v6jb_: