Lineage for d1v6hb_ (1v6h B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557585Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2557586Protein Cut A1 [89931] (5 species)
  7. 2557658Species Thermus thermophilus [TaxId:274] [89932] (2 PDB entries)
  8. 2557661Domain d1v6hb_: 1v6h B: [100381]
    structural genomics
    complexed with so4

Details for d1v6hb_

PDB Entry: 1v6h (more details), 1.9 Å

PDB Description: The Trimeric Structure Of Divalent Cation Tolerance Protein CutA1 From Thermus Thermophilus HB8
PDB Compounds: (B:) Divalent Cation Tolerance Protein CutA1

SCOPe Domain Sequences for d1v6hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6hb_ d.58.5.2 (B:) Cut A1 {Thermus thermophilus [TaxId: 274]}
meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
thafpklkervkalhpytvpeivalpiaegnreyldwlrentg

SCOPe Domain Coordinates for d1v6hb_:

Click to download the PDB-style file with coordinates for d1v6hb_.
(The format of our PDB-style files is described here.)

Timeline for d1v6hb_: