Lineage for d1v67a_ (1v67 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809648Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (3 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 809649Protein Ferripyochelin binding protein [101965] (1 species)
  7. 809650Species Archaeon Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries)
  8. 809653Domain d1v67a_: 1v67 A: [100379]
    complexed with bct, ca, zn

Details for d1v67a_

PDB Entry: 1v67 (more details), 2.3 Å

PDB Description: structure of ferripyochelin binding protein from pyrococcus horikoshii ot3
PDB Compounds: (A:) ferripyochelin binding protein

SCOP Domain Sequences for d1v67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v67a_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri

SCOP Domain Coordinates for d1v67a_:

Click to download the PDB-style file with coordinates for d1v67a_.
(The format of our PDB-style files is described here.)

Timeline for d1v67a_: