![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) |
![]() | Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102036] (1 PDB entry) |
![]() | Domain d1v5xb_: 1v5x B: [100378] |
PDB Entry: 1v5x (more details), 2 Å
SCOP Domain Sequences for d1v5xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5xb_ c.1.2.4 (B:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus} mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea pgvksaeklralfarlaslr
Timeline for d1v5xb_: