Lineage for d1v5xa_ (1v5x A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473421Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 473555Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 473574Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)
  7. 473582Species Thermus thermophilus [TaxId:274] [102036] (1 PDB entry)
  8. 473583Domain d1v5xa_: 1v5x A: [100377]

Details for d1v5xa_

PDB Entry: 1v5x (more details), 2 Å

PDB Description: Crystal structure of Phosphoribosyl anthranilate isomerase from Thermus Thermophilus

SCOP Domain Sequences for d1v5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus}
mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
pgvksaeklralfarlaslr

SCOP Domain Coordinates for d1v5xa_:

Click to download the PDB-style file with coordinates for d1v5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v5xb_