Lineage for d1v55o2 (1v55 O:1-90)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956781Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1956826Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1956827Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries)
  8. 1956839Domain d1v55o2: 1v55 O:1-90 [100365]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55o2

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (O:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1v55o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55o2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1v55o2:

Click to download the PDB-style file with coordinates for d1v55o2.
(The format of our PDB-style files is described here.)

Timeline for d1v55o2: