SCOP 1.71: Domain d1v55o1: 1v55 O:91-227

Lineage for d1v55o1 (1v55 O:91-227)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (7 PDB entries)

8. Domain d1v55o1: 1v55 O:91-227 [100364]
   Other proteins in same PDB: d1v55a_, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55o1

PDB Entry: 1v55, 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state

SCOP Domain Sequences for d1v55o1:

Sequence; same for both SEQRES and ATOM records:

>d1v55o1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d1v55o1:

• d1v55o1 first appeared in SCOP 1.67
  
• d1v55o1 appears in SCOP 1.69
  
• d1v55o1 appears in SCOP 1.73
  
• d1v55o1 appears in the current release, SCOPe 2.08