Lineage for d1v55n_ (1v55 N:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746107Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 746108Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 746109Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 746129Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 746130Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries)
  8. 746136Domain d1v55n_: 1v55 N: [100363]
    Other proteins in same PDB: d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55n_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (N:) Cytochrome c oxidase polypeptide I

SCOP Domain Sequences for d1v55n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55n_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOP Domain Coordinates for d1v55n_:

Click to download the PDB-style file with coordinates for d1v55n_.
(The format of our PDB-style files is described here.)

Timeline for d1v55n_: