Lineage for d1v55e_ (1v55 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340250Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2340251Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2340252Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)
  8. 2340267Domain d1v55e_: 1v55 E: [100354]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55e_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d1v55e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d1v55e_:

Click to download the PDB-style file with coordinates for d1v55e_.
(The format of our PDB-style files is described here.)

Timeline for d1v55e_: