Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d1v55b2: 1v55 B:1-90 [100351] Other proteins in same PDB: d1v55a_, d1v55b1, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 1v55 (more details), 1.9 Å
SCOPe Domain Sequences for d1v55b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v55b2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d1v55b2:
View in 3D Domains from other chains: (mouse over for more information) d1v55a_, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55h_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55u_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_ |