SCOPe 2.08: Domain d1v54o2: 1v54 O:1-90

Lineage for d1v54o2 (1v54 O:1-90)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)

8. Domain d1v54o2: 1v54 O:1-90 [100337]
   Other proteins in same PDB: d1v54a_, d1v54b1, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54o2

PDB Entry: 1v54, 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (O:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1v54o2:

Sequence; same for both SEQRES and ATOM records:

>d1v54o2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d1v54o2:

• d1v54o2 first appeared in SCOP 1.67
  
• d1v54o2 appears in SCOPe 2.07