Lineage for d1v54f_ (1v54 F:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430253Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 430337Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 430338Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 430339Species Cow (Bos taurus) [TaxId:9913] [57820] (7 PDB entries)
  8. 430340Domain d1v54f_: 1v54 F: [100327]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_

Details for d1v54f_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1v54f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1v54f_:

Click to download the PDB-style file with coordinates for d1v54f_.
(The format of our PDB-style files is described here.)

Timeline for d1v54f_: