Lineage for d1v54f_ (1v54 F:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036679Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 3036680Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 3036681Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries)
  8. 3036688Domain d1v54f_: 1v54 F: [100327]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54f_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOPe Domain Sequences for d1v54f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d1v54f_:

Click to download the PDB-style file with coordinates for d1v54f_.
(The format of our PDB-style files is described here.)

Timeline for d1v54f_: