Lineage for d1v4ya1 (1v4y A:7-61)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382243Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 382244Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 382340Family b.92.1.6: D-aminoacylase [82230] (1 protein)
  6. 382341Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species)
  7. 382342Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries)
  8. 382349Domain d1v4ya1: 1v4y A:7-61 [100315]
    Other proteins in same PDB: d1v4ya3

Details for d1v4ya1

PDB Entry: 1v4y (more details), 1.65 Å

PDB Description: the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation

SCOP Domain Sequences for d1v4ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ya1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis}
pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp

SCOP Domain Coordinates for d1v4ya1:

Click to download the PDB-style file with coordinates for d1v4ya1.
(The format of our PDB-style files is described here.)

Timeline for d1v4ya1: