Lineage for d1v4vb_ (1v4v B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910543Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
    automatically mapped to Pfam PF02350
  6. 2910544Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 2910557Species Thermus thermophilus [TaxId:274] [102679] (1 PDB entry)
  8. 2910559Domain d1v4vb_: 1v4v B: [100314]
    complexed with acy, gol

Details for d1v4vb_

PDB Entry: 1v4v (more details), 1.8 Å

PDB Description: Crystal Structure Of UDP-N-Acetylglucosamine 2-Epimerase From Thermus Thermophilus HB8
PDB Compounds: (B:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d1v4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4vb_ c.87.1.3 (B:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}
mkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqedrnld
vmqerqalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvghveag
lrsgnlkepfpeeanrrltdvltdldfaptplakanllkegkreegilvtgqtgvdavll
aaklgrlpeglpegpyvtvtmhrrenwpllsdlaqalkrvaeafphltfvypvhlnpvvr
eavfpvlkgvrnfvlldpleygsmaalmraslllvtdsgglqeegaalgvpvvvlrnvte
rpeglkagilklagtdpegvyrvvkgllenpeelsrmrkaknpygdgkaglmvargvawr
lglgprpedwlp

SCOPe Domain Coordinates for d1v4vb_:

Click to download the PDB-style file with coordinates for d1v4vb_.
(The format of our PDB-style files is described here.)

Timeline for d1v4vb_: