![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Glucokinase [102479] (1 species) Hexokinase D |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102480] (2 PDB entries) |
![]() | Domain d1v4sa2: 1v4s A:219-461 [100310] complexed with agc, mrk, na |
PDB Entry: 1v4s (more details), 2.3 Å
SCOP Domain Sequences for d1v4sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens)} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kac
Timeline for d1v4sa2: