Lineage for d1v4sa1 (1v4s A:14-218)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372883Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1372884Protein Glucokinase [102479] (1 species)
    Hexokinase D
  7. 1372885Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries)
  8. 1372890Domain d1v4sa1: 1v4s A:14-218 [100309]
    complexed with glc, mrk, na

Details for d1v4sa1

PDB Entry: 1v4s (more details), 2.3 Å

PDB Description: crystal structure of human glucokinase
PDB Compounds: (A:) glucokinase isoform 2

SCOPe Domain Sequences for d1v4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd
flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf
ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg
dfemdvvamvndtvatmiscyyedh

SCOPe Domain Coordinates for d1v4sa1:

Click to download the PDB-style file with coordinates for d1v4sa1.
(The format of our PDB-style files is described here.)

Timeline for d1v4sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v4sa2