Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Glucokinase [102479] (1 species) Hexokinase D |
Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries) |
Domain d1v4sa1: 1v4s A:14-218 [100309] complexed with glc, mrk, na |
PDB Entry: 1v4s (more details), 2.3 Å
SCOPe Domain Sequences for d1v4sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg dfemdvvamvndtvatmiscyyedh
Timeline for d1v4sa1: