Lineage for d1v4lf_ (1v4l F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614604Protein Snake coagglutinin beta chain [88867] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 614631Species Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId:103944] [103349] (1 PDB entry)
  8. 614634Domain d1v4lf_: 1v4l F: [100308]
    Other proteins in same PDB: d1v4la_, d1v4lc_, d1v4le_

Details for d1v4lf_

PDB Entry: 1v4l (more details), 2.8 Å

PDB Description: Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)
PDB Compounds: (F:)

SCOP Domain Sequences for d1v4lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4lf_ d.169.1.1 (F:) Snake coagglutinin beta chain {Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin}
gfccplgwssydehcyqvfqqkmnwedaekfctqqhrgshlvsfhsseevdfvvsktspi
lkhdfvwmglsnvwnecakewsdgtkldykawsgqsdcitskttdnqwlsmdcsskryvv
ckfqa

SCOP Domain Coordinates for d1v4lf_:

Click to download the PDB-style file with coordinates for d1v4lf_.
(The format of our PDB-style files is described here.)

Timeline for d1v4lf_: