Lineage for d1v4le_ (1v4l E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001668Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001706Species Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId:103944] [103345] (1 PDB entry)
  8. 3001709Domain d1v4le_: 1v4l E: [100307]
    Other proteins in same PDB: d1v4lb_, d1v4ld_, d1v4lf_

Details for d1v4le_

PDB Entry: 1v4l (more details), 2.8 Å

PDB Description: Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)
PDB Compounds: (E:) mucrocetin alpha chain

SCOPe Domain Sequences for d1v4le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4le_ d.169.1.1 (E:) Snake coagglutinin alpha chain {Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId: 103944]}
dfdcipgwsaydrycyqafsepknwedaesfceegvktshlvsiessgegdfvaqlvaek
iktsfqyvwiglriqnkeqqcrsewsdassvnyenlykqsskkcyalkkgtelrtwfnvy
cgrenpfvckytpec

SCOPe Domain Coordinates for d1v4le_:

Click to download the PDB-style file with coordinates for d1v4le_.
(The format of our PDB-style files is described here.)

Timeline for d1v4le_: