SCOP 1.71: Domain d1v4lc_: 1v4l C:

Lineage for d1v4lc_ (1v4l C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Snake coagglutinin alpha chain [88861] (9 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId:103944] [103345] (1 PDB entry)

8. Domain d1v4lc_: 1v4l C: [100305]
   Other proteins in same PDB: d1v4lb_, d1v4ld_, d1v4lf_

Details for d1v4lc_

PDB Entry: 1v4l, 2.8 Å

PDB Description: Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)

SCOP Domain Sequences for d1v4lc_:

Sequence; same for both SEQRES and ATOM records:

>d1v4lc_ d.169.1.1 (C:) Snake coagglutinin alpha chain {Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin}
dfdcipgwsaydrycyqafsepknwedaesfceegvktshlvsiessgegdfvaqlvaek
iktsfqyvwiglriqnkeqqcrsewsdassvnyenlykqsskkcyalkkgtelrtwfnvy
cgrenpfvckytpec

Timeline for d1v4lc_:

• d1v4lc_ first appeared in SCOP 1.67
  
• d1v4lc_ appears in SCOP 1.69
  
• d1v4lc_ appears in SCOP 1.73
  
• d1v4lc_ appears in the current release, SCOPe 2.08