Lineage for d1v4lb_ (1v4l B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001748Species Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId:103944] [103349] (1 PDB entry)
  8. 3001749Domain d1v4lb_: 1v4l B: [100304]
    Other proteins in same PDB: d1v4la_, d1v4lc_, d1v4le_

Details for d1v4lb_

PDB Entry: 1v4l (more details), 2.8 Å

PDB Description: Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)
PDB Compounds: (B:) mucrocetin beta chain

SCOPe Domain Sequences for d1v4lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4lb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Taiwan habu (Trimeresurus mucrosquamatus), mucrocetin [TaxId: 103944]}
gfccplgwssydehcyqvfqqkmnwedaekfctqqhrgshlvsfhsseevdfvvsktspi
lkhdfvwmglsnvwnecakewsdgtkldykawsgqsdcitskttdnqwlsmdcsskryvv
ckfqa

SCOPe Domain Coordinates for d1v4lb_:

Click to download the PDB-style file with coordinates for d1v4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1v4lb_: