Lineage for d1v4ka_ (1v4k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014349Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2014379Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 2014380Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
    Uniprot Q9X1M1
  8. 2014383Domain d1v4ka_: 1v4k A: [100302]
    complexed with so4; mutant

Details for d1v4ka_

PDB Entry: 1v4k (more details), 2.45 Å

PDB Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima s77f mutant
PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1v4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ka_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
yelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaisslaal
elvhlafllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnklrr
aflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelgedly
nlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfenrd
wsglmsfmrekgilkeceetlkvlvknviienswlrd

SCOPe Domain Coordinates for d1v4ka_:

Click to download the PDB-style file with coordinates for d1v4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1v4ka_: