![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (5 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
![]() | Protein Octoprenyl-diphosphate synthase [101455] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries) Uniprot Q9X1M1 |
![]() | Domain d1v4jb_: 1v4j B: [100301] complexed with so4; mutant |
PDB Entry: 1v4j (more details), 2.85 Å
SCOPe Domain Sequences for d1v4jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4jb_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla alelyhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf
Timeline for d1v4jb_: