Class a: All alpha proteins [46456] (284 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
Protein Octoprenyl-diphosphate synthase [101455] (1 species) |
Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries) Uniprot Q9X1M1 |
Domain d1v4eb_: 1v4e B: [100297] complexed with so4 |
PDB Entry: 1v4e (more details), 2.28 Å
SCOPe Domain Sequences for d1v4eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4eb_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf
Timeline for d1v4eb_: