SCOPe 2.02: Domain d1v4eb_: 1v4e B:

Lineage for d1v4eb_ (1v4e B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Octoprenyl-diphosphate synthase [101455] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
   Uniprot Q9X1M1

8. Domain d1v4eb_: 1v4e B: [100297]
   complexed with so4

Details for d1v4eb_

PDB Entry: 1v4e, 2.28 Å

PDB Description: Crystal Structure of Octaprenyl Pyrophosphate Synthase from Hyperthermophilic Thermotoga maritima

PDB Compounds: (B:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1v4eb_:

Sequence; same for both SEQRES and ATOM records:

>d1v4eb_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

Timeline for d1v4eb_:

• d1v4eb_ first appeared in SCOP 1.67
  
• d1v4eb_ appears in SCOPe 2.01
  
• d1v4eb_ appears in SCOPe 2.03
  
• d1v4eb_ appears in the current release, SCOPe 2.08