Lineage for d1v4eb_ (1v4e B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360883Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 360884Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 360885Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (2 proteins)
  6. 360901Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 360902Species Thermotoga maritima [TaxId:243274] [101456] (5 PDB entries)
  8. 360904Domain d1v4eb_: 1v4e B: [100297]
    complexed with so4

Details for d1v4eb_

PDB Entry: 1v4e (more details), 2.28 Å

PDB Description: Crystal Structure of Octaprenyl Pyrophosphate Synthase from Hyperthermophilic Thermotoga maritima

SCOP Domain Sequences for d1v4eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4eb_ a.128.1.1 (B:) Octoprenyl-diphosphate synthase {Thermotoga maritima}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

SCOP Domain Coordinates for d1v4eb_:

Click to download the PDB-style file with coordinates for d1v4eb_.
(The format of our PDB-style files is described here.)

Timeline for d1v4eb_: