Lineage for d1v4ea_ (1v4e A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504323Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 1504347Protein Octoprenyl-diphosphate synthase [101455] (1 species)
  7. 1504348Species Thermotoga maritima [TaxId:2336] [101456] (10 PDB entries)
    Uniprot Q9X1M1
  8. 1504349Domain d1v4ea_: 1v4e A: [100296]
    complexed with so4

Details for d1v4ea_

PDB Entry: 1v4e (more details), 2.28 Å

PDB Description: Crystal Structure of Octaprenyl Pyrophosphate Synthase from Hyperthermophilic Thermotoga maritima
PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d1v4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnkl
rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrdf

SCOPe Domain Coordinates for d1v4ea_:

Click to download the PDB-style file with coordinates for d1v4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1v4ea_: