Lineage for d1v47b2 (1v47 B:136-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860766Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2860767Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2860799Species Thermus thermophilus [TaxId:274] [102262] (1 PDB entry)
    lacks the C-terminal domain
  8. 2860801Domain d1v47b2: 1v47 B:136-347 [100295]
    Other proteins in same PDB: d1v47a1, d1v47b1
    complexed with adx, cl, na, zn

Details for d1v47b2

PDB Entry: 1v47 (more details), 2.49 Å

PDB Description: Crystal structure of ATP sulfurylase from Thermus thermophillus HB8 in complex with APS
PDB Compounds: (B:) ATP sulfurylase

SCOPe Domain Sequences for d1v47b2:

Sequence, based on SEQRES records: (download)

>d1v47b2 c.26.1.5 (B:136-347) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]}
rtplektpeevraffrqrgwrkvvafqtrnaphraheylirlgleladgvlvhpilgakk
pddfpteviveayqalirdflpqervaffglatpmryagpkeavfhalvrknfgathflv
grdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggiasertcpeghrekrt
aismtkvrallregkappselvrpellpilrr

Sequence, based on observed residues (ATOM records): (download)

>d1v47b2 c.26.1.5 (B:136-347) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]}
rtplektpeevraffrqrgwrkvvafqtrnaphraheylirlgleladgvlvhpilgakk
pddfpteviveayqalirdflpqervaffglatpmryagpkeavfhalvrknfgathflv
grdhagvgdfydpyaahrifdrlpplgieivkvgavfhcplcggiasertcpeghrekrt
aismtkvrallegkappselvrpellpilrr

SCOPe Domain Coordinates for d1v47b2:

Click to download the PDB-style file with coordinates for d1v47b2.
(The format of our PDB-style files is described here.)

Timeline for d1v47b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v47b1