Lineage for d1v47b1 (1v47 B:4-135)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1813773Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1813774Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1813843Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 1813844Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 1813876Species Thermus thermophilus [TaxId:274] [102027] (1 PDB entry)
  8. 1813878Domain d1v47b1: 1v47 B:4-135 [100294]
    Other proteins in same PDB: d1v47a2, d1v47b2
    complexed with adx, cl, na, zn

Details for d1v47b1

PDB Entry: 1v47 (more details), 2.49 Å

PDB Description: Crystal structure of ATP sulfurylase from Thermus thermophillus HB8 in complex with APS
PDB Compounds: (B:) ATP sulfurylase

SCOPe Domain Sequences for d1v47b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v47b1 b.122.1.3 (B:4-135) ATP sulfurylase N-terminal domain {Thermus thermophilus [TaxId: 274]}
tlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfre
kprvgpgntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpya
lagrvevlkprp

SCOPe Domain Coordinates for d1v47b1:

Click to download the PDB-style file with coordinates for d1v47b1.
(The format of our PDB-style files is described here.)

Timeline for d1v47b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v47b2