Class b: All beta proteins [48724] (177 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins) archaeal hexapeptide repeat proteins this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain |
Protein Ferripyochelin binding protein [101965] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries) |
Domain d1v3wa_: 1v3w A: [100291] complexed with ca, cl, edo, gol, zn |
PDB Entry: 1v3w (more details), 1.5 Å
SCOPe Domain Sequences for d1v3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Pyrococcus horikoshii [TaxId: 53953]} maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri
Timeline for d1v3wa_: