SCOP 1.67: Domain d1v3fa_: 1v3f A:

Lineage for d1v3fa_ (1v3f A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (4 proteins)
   membrane-binding domain

6. Protein Pleckstrin 2 [101041] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101042] (1 PDB entry)

8. Domain d1v3fa_: 1v3f A: [100289]

Details for d1v3fa_

PDB Entry: 1v3f

PDB Description: solution structure of the dep domain of mouse pleckstrin2

SCOP Domain Sequences for d1v3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1v3fa_ a.4.5.31 (A:) Pleckstrin 2 {Mouse (Mus musculus)}
gssgssglhrivdkmhdtstgirpspnmeqgstykktflgsslvdwlissnfaasrleav
tlasmlmeenflrpvgvrsmgairsgdlaeqflddstalytfaesykkkvsskesgpssg

Timeline for d1v3fa_:

• d1v3fa_ is new in SCOP 1.67
  
• d1v3fa_ appears in SCOP 1.69
  
• d1v3fa_ appears in the current release, SCOPe 2.08, called d1v3fa1