Lineage for d1v3fa1 (1v3f A:8-114)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693893Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2693900Protein Pleckstrin 2 [101041] (1 species)
  7. 2693901Species Mouse (Mus musculus) [TaxId:10090] [101042] (1 PDB entry)
  8. 2693902Domain d1v3fa1: 1v3f A:8-114 [100289]
    Other proteins in same PDB: d1v3fa2, d1v3fa3

Details for d1v3fa1

PDB Entry: 1v3f (more details)

PDB Description: solution structure of the dep domain of mouse pleckstrin2
PDB Compounds: (A:) Pleckstrin 2

SCOPe Domain Sequences for d1v3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3fa1 a.4.5.31 (A:8-114) Pleckstrin 2 {Mouse (Mus musculus) [TaxId: 10090]}
lhrivdkmhdtstgirpspnmeqgstykktflgsslvdwlissnfaasrleavtlasmlm
eenflrpvgvrsmgairsgdlaeqflddstalytfaesykkkvsske

SCOPe Domain Coordinates for d1v3fa1:

Click to download the PDB-style file with coordinates for d1v3fa1.
(The format of our PDB-style files is described here.)

Timeline for d1v3fa1: