SCOPe 2.07: Domain d1v3fa1: 1v3f A:8-114

Lineage for d1v3fa1 (1v3f A:8-114)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (5 proteins)
   membrane-binding domain

6. Protein Pleckstrin 2 [101041] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101042] (1 PDB entry)

8. Domain d1v3fa1: 1v3f A:8-114 [100289]
   Other proteins in same PDB: d1v3fa2, d1v3fa3

Details for d1v3fa1

PDB Entry: 1v3f

PDB Description: Solution structure of the DEP domain of mouse pleckstrin2

PDB Compounds: (A:) Pleckstrin 2

SCOPe Domain Sequences for d1v3fa1:

Sequence; same for both SEQRES and ATOM records:

>d1v3fa1 a.4.5.31 (A:8-114) Pleckstrin 2 {Mouse (Mus musculus) [TaxId: 10090]}
lhrivdkmhdtstgirpspnmeqgstykktflgsslvdwlissnfaasrleavtlasmlm
eenflrpvgvrsmgairsgdlaeqflddstalytfaesykkkvsske

Timeline for d1v3fa1:

• d1v3fa1 first appeared in SCOP 1.67, called d1v3fa_
  
• d1v3fa1 appears in SCOPe 2.06