Lineage for d1v3ca_ (1v3c A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379505Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 379506Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 379507Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 379508Protein Hemagglutinin-neuraminidase glycoprotein [101891] (1 species)
  7. 379509Species Human parainfluenza virus type III [101892] (5 PDB entries)
  8. 379516Domain d1v3ca_: 1v3c A: [100283]

Details for d1v3ca_

PDB Entry: 1v3c (more details), 2.3 Å

PDB Description: structure of the hemagglutinin-neuraminidase from human parainfluenza virus type iii: complex with neu5ac

SCOP Domain Sequences for d1v3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ca_ b.68.1.1 (A:) Hemagglutinin-neuraminidase glycoprotein {Human parainfluenza virus type III}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
lfkteipkscs

SCOP Domain Coordinates for d1v3ca_:

Click to download the PDB-style file with coordinates for d1v3ca_.
(The format of our PDB-style files is described here.)

Timeline for d1v3ca_:

Domains from other chains:
(mouse over for more information)
d1v3cb_