![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein Sam-domain protein samsn-1 [101248] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [101249] (1 PDB entry) |
![]() | Domain d1v38a1: 1v38 A:8-72 [100280] Other proteins in same PDB: d1v38a2, d1v38a3 |
PDB Entry: 1v38 (more details)
SCOPe Domain Sequences for d1v38a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v38a1 a.60.1.2 (A:8-72) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} rrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadpedrarllsa aesll
Timeline for d1v38a1: