Lineage for d1v38a1 (1v38 A:8-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715521Protein Sam-domain protein samsn-1 [101248] (1 species)
  7. 2715522Species Mouse (Mus musculus) [TaxId:10090] [101249] (1 PDB entry)
  8. 2715523Domain d1v38a1: 1v38 A:8-72 [100280]
    Other proteins in same PDB: d1v38a2, d1v38a3

Details for d1v38a1

PDB Entry: 1v38 (more details)

PDB Description: solution structure of the sterile alpha motif (sam) domain of mouse samsn1
PDB Compounds: (A:) SAM-domain protein SAMSN-1

SCOPe Domain Sequences for d1v38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v38a1 a.60.1.2 (A:8-72) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]}
rrenhqtiqeflerihlqeytstlllngyetlddlkdikeshlielniadpedrarllsa
aesll

SCOPe Domain Coordinates for d1v38a1:

Click to download the PDB-style file with coordinates for d1v38a1.
(The format of our PDB-style files is described here.)

Timeline for d1v38a1: