SCOPe 2.06: Domain d1v32a1: 1v32 A:8-95

Lineage for d1v32a1 (1v32 A:8-95)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein Hypothetical protein AT5G08430 (rafl09-47-k03) [101201] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101202] (1 PDB entry)

8. Domain d1v32a1: 1v32 A:8-95 [100277]
   Other proteins in same PDB: d1v32a2, d1v32a3
   structural genomics

Details for d1v32a1

PDB Entry: 1v32

PDB Description: solution structure of the swib/mdm2 domain of the hypothetical protein at5g08430 from arabidopsis thaliana

PDB Compounds: (A:) hypothetical protein RAFL09-47-K03

SCOPe Domain Sequences for d1v32a1:

Sequence; same for both SEQRES and ATOM records:

>d1v32a1 a.42.1.1 (A:8-95) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkkkvvcdkr
lvllfgtrtifrmkvydllekhykenqd

Timeline for d1v32a1:

• d1v32a1 first appeared in SCOP 1.67, called d1v32a_
  
• d1v32a1 was called d1v32a_ in SCOPe 2.05
  
• d1v32a1 appears in SCOPe 2.07
  
• d1v32a1 appears in the current release, SCOPe 2.08