Class a: All alpha proteins [46456] (202 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (3 proteins) Pfam 02201 |
Protein Hypothetical protein AT5G08430 (rafl09-47-k03) [101201] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101202] (1 PDB entry) |
Domain d1v32a_: 1v32 A: [100277] structural genomics |
PDB Entry: 1v32 (more details)
SCOP Domain Sequences for d1v32a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v32a_ a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana)} gssgssgkrfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkk kvvcdkrlvllfgtrtifrmkvydllekhykenqdsgpssg
Timeline for d1v32a_: