Lineage for d1v32a1 (1v32 A:8-95)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996222Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1996223Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1996224Family a.42.1.1: SWIB/MDM2 domain [47593] (5 protein domains)
    Pfam PF02201
  6. 1996225Protein Hypothetical protein AT5G08430 (rafl09-47-k03) [101201] (1 species)
  7. 1996226Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101202] (1 PDB entry)
  8. 1996227Domain d1v32a1: 1v32 A:8-95 [100277]
    Other proteins in same PDB: d1v32a2, d1v32a3
    structural genomics

Details for d1v32a1

PDB Entry: 1v32 (more details)

PDB Description: Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g08430 from Arabidopsis thaliana
PDB Compounds: (A:) hypothetical protein RAFL09-47-K03

SCOPe Domain Sequences for d1v32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v32a1 a.42.1.1 (A:8-95) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkkkvvcdkr
lvllfgtrtifrmkvydllekhykenqd

SCOPe Domain Coordinates for d1v32a1:

Click to download the PDB-style file with coordinates for d1v32a1.
(The format of our PDB-style files is described here.)

Timeline for d1v32a1: