Lineage for d1v2ya1 (1v2y A:8-99)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539511Protein Ubiquitin-like protein 3300001g02rik [102784] (1 species)
  7. 2539512Species Mouse (Mus musculus) [TaxId:10090] [102785] (1 PDB entry)
  8. 2539513Domain d1v2ya1: 1v2y A:8-99 [100275]
    Other proteins in same PDB: d1v2ya2, d1v2ya3
    structural genomics

Details for d1v2ya1

PDB Entry: 1v2y (more details)

PDB Description: solution structure of mouse hypothetical gene (riken cdna 3300001g02) product homologous to ubiquitin fold
PDB Compounds: (A:) 3300001G02Rik protein

SCOPe Domain Sequences for d1v2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ya1 d.15.1.1 (A:8-99) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]}
mtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvwrtyhlts
agekltedrkklrdygirnrdevsfikklgqk

SCOPe Domain Coordinates for d1v2ya1:

Click to download the PDB-style file with coordinates for d1v2ya1.
(The format of our PDB-style files is described here.)

Timeline for d1v2ya1: