Lineage for d1v2xa_ (1v2x A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528468Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 2528486Protein tRNA (Gm18) methyltransferase TrmH [102279] (1 species)
  7. 2528487Species Thermus thermophilus [TaxId:274] [102280] (1 PDB entry)
  8. 2528488Domain d1v2xa_: 1v2x A: [100274]
    complexed with po4, sam

Details for d1v2xa_

PDB Entry: 1v2x (more details), 1.5 Å

PDB Description: trmh
PDB Compounds: (A:) tRNA (Gm18) methyltransferase

SCOPe Domain Sequences for d1v2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2xa_ c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH {Thermus thermophilus [TaxId: 274]}
mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
pelyqkvladw

SCOPe Domain Coordinates for d1v2xa_:

Click to download the PDB-style file with coordinates for d1v2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1v2xa_: