Lineage for d1v2xa_ (1v2x A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404674Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 404675Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 404676Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 404694Protein tRNA (Gm18) methyltransferase TrmH [102279] (1 species)
  7. 404695Species Thermus thermophilus [TaxId:274] [102280] (1 PDB entry)
  8. 404696Domain d1v2xa_: 1v2x A: [100274]
    complexed with po4, sam

Details for d1v2xa_

PDB Entry: 1v2x (more details), 1.5 Å

PDB Description: trmh

SCOP Domain Sequences for d1v2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2xa_ c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH {Thermus thermophilus}
mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
pelyqkvladw

SCOP Domain Coordinates for d1v2xa_:

Click to download the PDB-style file with coordinates for d1v2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1v2xa_: