Lineage for d1v2ib_ (1v2i B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064983Protein Hemagglutinin-neuraminidase glycoprotein [101891] (1 species)
  7. 2064984Species Human parainfluenza virus type 3 [TaxId:11216] [101892] (5 PDB entries)
  8. 2064990Domain d1v2ib_: 1v2i B: [100273]
    complexed with ca, nag, ndg, po4

Details for d1v2ib_

PDB Entry: 1v2i (more details), 2.2 Å

PDB Description: Structure of the hemagglutinin-neuraminidase from human parainfluenza virus type III
PDB Compounds: (B:) hemagglutinin-neuraminidase glycoprotein

SCOPe Domain Sequences for d1v2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ib_ b.68.1.1 (B:) Hemagglutinin-neuraminidase glycoprotein {Human parainfluenza virus type 3 [TaxId: 11216]}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
lfkteipkscs

SCOPe Domain Coordinates for d1v2ib_:

Click to download the PDB-style file with coordinates for d1v2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ib_: