Lineage for d1v2he_ (1v2h E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495769Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2495958Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries)
    Uniprot P00491
  8. 2495968Domain d1v2he_: 1v2h E: [100271]
    complexed with gun, so4

Details for d1v2he_

PDB Entry: 1v2h (more details), 2.7 Å

PDB Description: Crystal structure of human PNP complexed with guanine
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1v2he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2he_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas

SCOPe Domain Coordinates for d1v2he_:

Click to download the PDB-style file with coordinates for d1v2he_.
(The format of our PDB-style files is described here.)

Timeline for d1v2he_: