SCOPe 2.07: Domain d1v2ab2: 1v2a B:1-83

Lineage for d1v2ab2 (1v2a B:1-83)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class delta GST [81366] (6 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [102440] (1 PDB entry)

8. Domain d1v2ab2: 1v2a B:1-83 [100266]
   Other proteins in same PDB: d1v2aa1, d1v2ab1, d1v2ac1, d1v2ad1
   complexed with gts

Details for d1v2ab2

PDB Entry: 1v2a, 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B

PDB Compounds: (B:) glutathione transferase gst1-6

SCOPe Domain Sequences for d1v2ab2:

Sequence; same for both SEQRES and ATOM records:

>d1v2ab2 c.47.1.5 (B:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}
mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
vwesyaivlylvetyakddtlyp

Timeline for d1v2ab2:

• d1v2ab2 first appeared in SCOP 1.67
  
• d1v2ab2 appears in SCOPe 2.06
  
• d1v2ab2 appears in the current release, SCOPe 2.08