Lineage for d1v1sa_ (1v1s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904327Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2904328Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 2904334Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries)
  8. 2904343Domain d1v1sa_: 1v1s A: [100256]
    structural genomics

Details for d1v1sa_

PDB Entry: 1v1s (more details), 3.2 Å

PDB Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus (crystal form 2)
PDB Compounds: (A:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1v1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1sa_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]}
mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
lk

SCOPe Domain Coordinates for d1v1sa_:

Click to download the PDB-style file with coordinates for d1v1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1v1sa_: